Antibody data

Product number
H00010194-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010194-M07, RRID:AB_607004
Product name
SDCCAG33 monoclonal antibody (M07), clone 2F1
Provider product page
Abnova Corporation - H00010194-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SDCCAG33.
Antigen sequence
SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAE
TGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGII
MDHSPEPSFINPLSALQSIMNTHLGKVSK
Isotype
IgG
Antibody clone number
2F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -