PAB22056

VEZF1 antibody from Abnova Corporation
DB1, ZNF161

Antibody data

Product number
PAB22056
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22056, RRID:AB_10963291
Product name
VEZF1 polyclonal antibody
Provider product page
Abnova Corporation - PAB22056
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant VEZF1.
Antigen sequence
RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFS
ITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNIT
SPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTA
PVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -