HPA021812

antibody from Atlas Antibodies

Targeting: MKS1 BBS13, FLJ20345, MKS, POC12

Western blot

Antibody data

Submit

Validation data

Product number: HPA021812 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021812, RRID:AB_2142654
Product name: Anti-MKS1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDAL PEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGS HTLTVSTWRPVELGTVA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MKS1 protein structure - HPA021812 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, fallopian tube and kidney using Anti-MKS1 antibody HPA021812 (A) shows similar protein distribution across tissues to independent antibody HPA021372 (B).
Antibody #2 product nr: HPA021372
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-MKS1 antibody HPA021812.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MKS1 antibody HPA021812.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MKS1 antibody HPA021812.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MKS1 antibody HPA021812.
Sample type: HUMAN