PAB21735

TSPOAP1 antibody from Abnova Corporation
BZRAP1, KIAA0612, PRAX-1, RIM-BP1, RIMBP1

Antibody data

Product number
PAB21735
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21735, RRID:AB_10984307
Product name
BZRAP1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21735
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant BZRAP1.
Antigen sequence
DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTP
PAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAE
ACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNM
SFGD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -