Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003351-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003351-A01, RRID:AB_489489
- Product name
- HTR1B polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HTR1B.
- Antigen sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSA
KDYIYQDSISLPWK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A noncanonical postsynaptic transport route for a GPCR belonging to the serotonin receptor family.
Liebmann T, Kruusmägi M, Sourial-Bassillious N, Bondar A, Svenningsson P, Flajolet M, Greengard P, Scott L, Brismar H, Aperia A
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):17998-8008
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):17998-8008
No comments: Submit comment
No validations: Submit validation data