Antibody data

Product number
H00007984-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007984-M02, RRID:AB_10547113
Product name
ARHGEF5 monoclonal antibody (M02), clone 4D10-D11
Provider product page
Abnova Corporation - H00007984-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ARHGEF5.
Antigen sequence
MGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQ
RLESLSETPGPSSPRQPRKALVSSESYLQRLSMAS
SGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELI
VSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWL
FSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVV
LNHAPDFRRVYLPYVTNQTYQERTFQSLMNSNSNF
REVLEKLESDPVCQRLSLKSFLILPFQRITRLKLL
LQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNN
VQSMRRTEELIYLSQKIEFECKIFPLISQSRWLVK
SGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLL
SRPREGSRFLVFDHAPFSSIRGEKCEMKLHGPHKN
LFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALA
MPREELDLLECYNSPQVQCLRAYKPRENDELALEK
ADVVMVTQQSSDGWLEGVRLSDGERGWFPVQQVEF
ISNPEVRAQNLKEAHRVKTAKLQLVEQQA
Isotype
IgG
Antibody clone number
4D10-D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -