HPA029504

ARHGEF5 antibody from MilliporeSigma / Merck KGaA
GEF5, P60, TIM, TIM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029504
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029504, RRID:AB_10602231
Product name
Anti-ARHGEF5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029504
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor (GEF) 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISAL
AMPREELDLLECYNSPQVQCLRAYKPRENDELALE
KADVVMVTQQSSDGWLEGVRLSDG
Storage
-20C
Provider Type Product Number
- No reagents -