Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502198 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome B-561 (CYB561) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYB561 antibody: synthetic peptide directed towards the middle region of human CYB561
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLG
LKEAL LFNLGGKYSA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic variation within adrenergic pathways determines in vivo effects of presynaptic stimulation in humans.
Fung MM, Nguyen C, Mehtani P, Salem RM, Perez B, Thomas B, Das M, Schork NJ, Mahata SK, Ziegler MG, O'Connor DT
Circulation 2008 Jan 29;117(4):517-25
Circulation 2008 Jan 29;117(4):517-25
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting