SAB2100515

CYB561 antibody from Sigma-Aldrich
CYB561A1, FRRS2
No application information provided.

Antibody data

Product number
SAB2100515
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100515, RRID:AB_10599472
Product name
Anti-CYB561 (ab1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100515
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001017916.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALS
MDFKTLTEGDSPGSQ
Storage
-20C
Provider Type Product Number
- No reagents -