HPA012636

NUDT1 antibody from Atlas Antibodies
MTH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012636
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012636, RRID:AB_1854696
Product name
Anti-NUDT1
Provider product page
Atlas Antibodies - HPA012636
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RWNGFGGKVQEGETIEDGARRELQEESGLTVDALH
KVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDE
MRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHG
YFKFQGQDTILDYTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -