Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006915 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006915, RRID:AB_1853669
- Product name
- Anti-MDC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REAVLKDHTKIRALVRAHSEKDQPPFGDSDDSVEA
DKSSPGIHLERSQASTTVDINTQVEKEVPPGSAII
HIKKHQVSVEGTNQTDVKAVGGPAKLLVVSLEEAW
PLHGDCETDAEEGTSLTASVVADVRKSQLPAEGDA
G- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The RNA-binding protein fused in sarcoma (FUS) functions downstream of poly(ADP-ribose) polymerase (PARP) in response to DNA damage.
Mastrocola AS, Kim SH, Trinh AT, Rodenkirch LA, Tibbetts RS
The Journal of biological chemistry 2013 Aug 23;288(34):24731-41
The Journal of biological chemistry 2013 Aug 23;288(34):24731-41
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & focal adhesion sites.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and liver tissues using Anti-MDC1 antibody. Corresponding MDC1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN