WH0008438M1

RAD54L antibody from MilliporeSigma / Merck KGaA
hHR54, hRAD54, RAD54A
ELISA
Recommended by provider

Antibody data

Product number
WH0008438M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0008438M1, RRID:AB_1843253
Product name
Monoclonal Anti-RAD54L antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008438M1
Antibody type
Monoclonal
Antigen
RAD54L (NP_003570, a.a. 638-748) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
KKALSSCVVDEEQDVERHFSLGELKELFILDEASL
SDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWN
HCTDKWGLRDEVLQAAWDAASTAITFVFHQHSHEE
QRGLR* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -