HPA010568

antibody from Atlas Antibodies

Targeting: KIF11 Eg5, HKSP, KNSL1, TRIP5

Western blot

Antibody data

Submit

Validation data

Product number: HPA010568 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010568, RRID:AB_1848034
Product name: Anti-KIF11
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRV MSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMD NKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KIF11 protein structure - HPA010568 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA010568 antibody. Corresponding KIF11 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity, mainly in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN