HPA018493

antibody from Atlas Antibodies

Targeting: BAG3

Antibody data

Submit

Validation data

Product number: HPA018493 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018493, RRID:AB_1845257
Product name: Anti-BAG3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAID VPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKG KKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPG NPAAP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BAG3 protein structure - HPA018493 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-BAG3 antibody. Corresponding BAG3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-BAG3 antibody HPA018493 (A) shows similar protein distribution across tissues to independent antibody HPA020586 (B).
Antibody #2 product nr: HPA020586
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human oral mucosa shows strong positivity in squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-BAG3 antibody HPA018493.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-BAG3 antibody HPA018493.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-BAG3 antibody HPA018493.
Sample type: HUMAN