HPA019652

POU2F3 antibody from Atlas Antibodies
Epoc-1, OCT11, PLA-1, Skn-1a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019652, RRID:AB_1855585
Product name
Anti-POU2F3
Provider product page
Atlas Antibodies - HPA019652
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNG
LDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMS
GNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVS
QFLLSQTQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -