Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005454-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005454-M01, RRID:AB_489818
- Product name
- POU3F2 monoclonal antibody (M01), clone 6F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POU3F2.
- Antigen sequence
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYR
EAQSLVQGDYGALQSNGHPLSHAHQWITALSH- Isotype
- IgG
- Antibody clone number
- 6F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Allele-specific silencing of mutant huntingtin and ataxin-3 genes by targeting expanded CAG repeats in mRNAs.
Hu J, Matsui M, Gagnon KT, Schwartz JC, Gabillet S, Arar K, Wu J, Bezprozvanny I, Corey DR
Nature biotechnology 2009 May;27(5):478-84
Nature biotechnology 2009 May;27(5):478-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody (M01), clone 6F6.Lane 1: POU3F2 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- POU3F2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of POU3F2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged POU3F2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
