HPA003435

antibody from Atlas Antibodies

Targeting: SYNE2 DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2

Antibody data

Submit

Validation data

Product number: HPA003435 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003435, RRID:AB_1080162
Product name: Anti-SYNE2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYR VDVGNPEESLEMPLRKQEELESTVARIQDLTEKLG MISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETE AE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SYNE2 protein structure - HPA003435 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-SYNE2 antibody HPA003435 (A) shows similar protein distribution across tissues to independent antibody HPA050204 (B).
Antibody #2 product nr: HPA050204
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong nuclear membrane positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SYNE2 antibody HPA003435.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SYNE2 antibody HPA003435.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SYNE2 antibody HPA003435.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SYNE2 antibody HPA003435.
Sample type: HUMAN