Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183548 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKD
LQDVS ITVLNVTLND- Vial size
- 50 µg
Submitted references Differential expression of sodium channel β subunits in dorsal root ganglion sensory neurons.
A mutation in the beta 3 subunit of the cardiac sodium channel associated with Brugada ECG phenotype.
Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Ho C, Zhao J, Malinowski S, Chahine M, O'Leary ME
The Journal of biological chemistry 2012 Apr 27;287(18):15044-53
The Journal of biological chemistry 2012 Apr 27;287(18):15044-53
A mutation in the beta 3 subunit of the cardiac sodium channel associated with Brugada ECG phenotype.
Hu D, Barajas-Martinez H, Burashnikov E, Springer M, Wu Y, Varro A, Pfeiffer R, Koopmann TT, Cordeiro JM, Guerchicoff A, Pollevick GD, Antzelevitch C
Circulation. Cardiovascular genetics 2009 Jun;2(3):270-8
Circulation. Cardiovascular genetics 2009 Jun;2(3):270-8
Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Lazrek M, Goffard A, Schanen C, Karquel C, Bocket L, Lion G, Devaux M, Hedouin V, Gosset D, Hober D
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S
Genome research 2006 Jan;16(1):55-65
Genome research 2006 Jan;16(1):55-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting