Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003436 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003436, RRID:AB_1078523
- Product name
- Anti-VSX2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAG
VGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQP
LGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQ
TKKRKKRRHRTIFTSYQLEELEKAFNEAH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references RB116: an RB1+ retinoblastoma cell line expressing primitive markers.
Bejjani A, Choi MR, Cassidy L, Collins DW, O'Brien JM, Murray T, Ksander BR, Seigel GM
Molecular vision 2012;18:2805-13
Molecular vision 2012;18:2805-13
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405387).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human oral mucosa shows moderate nuclear(nucleolar) positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human retina shows strong nuclear positivity in inner nuclear layer.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
- Sample type
- HUMAN