HPA046502

NELFE antibody from Atlas Antibodies
D6S45, NELF-E, RD, RDBP, RDP

Antibody data

Product number
HPA046502
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046502, RRID:AB_2679677
Product name
Anti-NELFE
Provider product page
Atlas Antibodies - HPA046502
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV
TYEKMESADQAVAELNGTQVESVQLKVNIARKQPM
LDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDD
VYKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -