PAB20363

NELFE antibody from Abnova Corporation
D6S45, NELF-E, RD, RDBP, RDP

Antibody data

Product number
PAB20363
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20363, RRID:AB_10964934
Product name
RDBP polyclonal antibody
Provider product page
Abnova Corporation - PAB20363
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RDBP.
Antigen sequence
LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATE
QAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKD
PEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLY
ESFVSSSDRLRELGPDG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -