Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501966 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RD RNA Binding Protein (RDBP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RDBP antibody: synthetic peptide directed towards the N terminal of human RDBP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQS
SSSTT SQGGVKRSLS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Quantitative phosphoproteomic analysis of early alterations in protein phosphorylation by 2,3,7,8-tetrachlorodibenzo-p-dioxin.
NELF-E RRM undergoes major structural changes in flexible protein regions on target RNA binding.
Schulz M, Brandner S, Eberhagen C, Eckardt-Schupp F, Larsen MR, Andrae U
Journal of proteome research 2013 Feb 1;12(2):866-82
Journal of proteome research 2013 Feb 1;12(2):866-82
NELF-E RRM undergoes major structural changes in flexible protein regions on target RNA binding.
Rao JN, Schweimer K, Wenzel S, Wöhrl BM, Rösch P
Biochemistry 2008 Mar 25;47(12):3756-61
Biochemistry 2008 Mar 25;47(12):3756-61
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting