SAB2101972

NELFE antibody from MilliporeSigma / Merck KGaA
D6S45, NELF-E, RD, RDBP, RDP
No application information provided.

Antibody data

Product number
SAB2101972
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101972, RRID:AB_10607602
Product name
Anti-RDBP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101972
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_002895.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQS
SSSTTSQGGVKRSLS
Storage
-20C
Provider Type Product Number
- No reagents -