HPA023245

antibody from Atlas Antibodies

Targeting: ARSG KIAA1001

Antibody data

Submit

Validation data

Product number: HPA023245 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023245, RRID:AB_1845056
Product name: Anti-ARSG
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHD MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDV ALPLYENLNIVEQPV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ARSG protein structure - HPA023245 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and pancreas using Anti-ARSG antibody HPA023245 (A) shows similar protein distribution across tissues to independent antibody HPA023285 (B).
Antibody #2 product nr: HPA023285
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells while islets and intercalated ducts were negative.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ARSG antibody HPA023245.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ARSG antibody HPA023245.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ARSG antibody HPA023245.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-ARSG antibody HPA023245.
Sample type: HUMAN