HPA025767

MRPL37 antibody from Atlas Antibodies

MRP-L2, RPML2

Western blot: Supportive data in Antibodypedia

Immunohistochemistry: Enhanced validation

Provider product page for HPA025767

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [2]
Immunohistochemistry [8]

Submit

Validation data

Product number: HPA025767
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025767, RRID:AB_1854105
Product name: Anti-MRPL37
Provider product page: Atlas Antibodies - HPA025767
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQL LYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLA LYLHGA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate granular positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-MRPL37 antibody. Corresponding MRPL37 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more