HPA007131

antibody from Atlas Antibodies

Targeting: ADGRF4 FLJ38076, GPR115, PGR18

Antibody data

Submit

Validation data

Product number: HPA007131 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007131, RRID:AB_2667756
Product name: Anti-ADGRF4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFH GEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGAS RLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPF DYACITDMVKSSETTSGNIAFIVELLKNISTDLSD NVTR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ADGRF4 protein structure - HPA007131 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA007131 antibody. Corresponding ADGRF4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows cytoplasmic positivity in epidermal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic positivity in keratinocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN