HPA016704
antibody from Atlas Antibodies
Targeting: EP400
CAGH32, DKFZP434I225, KIAA1498, KIAA1818, P400, TNRC12
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016704 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016704, RRID:AB_1854888
- Product name
- Anti-EP400
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAE
LPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEED
ADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIG
KPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPS
L- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ANP32E is a histone chaperone that removes H2A.Z from chromatin
Obri A, Ouararhni K, Papin C, Diebold M, Padmanabhan K, Marek M, Stoll I, Roy L, Reilly P, Mak T, Dimitrov S, Romier C, Hamiche A
Nature 2014 January;505(7485):648-653
Nature 2014 January;505(7485):648-653
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and liver tissues using HPA016704 antibody. Corresponding EP400 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gall bladder shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate nuclear positivity in smooth muscle cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes.
- Sample type
- HUMAN