Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183916 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWV
IDQKK PVRFYHDWND- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A, Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A
Genome research 2001 Mar;11(3):422-35
Genome research 2001 Mar;11(3):422-35
No comments: Submit comment
No validations: Submit validation data