AMAb91123
antibody from Atlas Antibodies
Targeting: LAMA3
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91123 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91123, RRID:AB_2665808
- Product name
- Anti-LAMA3
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLS
DLRARLQEAAAQAKQANGLNQENERALGAIQRQVK
EINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQK
EYE- Epitope
- Binds to an epitope located within the peptide sequence EINSLQSDFT as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3112
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control).