SAB1400528

NT5C antibody from Sigma-Aldrich
cdN, DNT-1, DNT1, PN-I, UMPH2
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
SAB1400528
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400528, RRID:AB_1854661
Product name
Anti-NT5C antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400528
Antibody type
Polyclonal
Antigen
NT5C (AAH08183.1, a.a. 1-117) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPH
VPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF
FLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKV
WLPRPYSARGAA (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -