HPA008066

antibody from Atlas Antibodies

Targeting: CALD1 CDM, H-CAD, L-CAD

Western blot (Enhanced validation)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA008066

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA008066, RRID:AB_1078378

Product name

Anti-CALD1

Antibody type

Polyclonal

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDS
RLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNI
KSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRIN
EWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQ
SVDKVTS


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Stromal gene expression defines poor-prognosis subtypes in colorectal cancer

Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329

---

Stromal gene expression defines poor-prognosis subtypes in colorectal cancer

Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329

---

Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251

---

Histochemical localization of caldesmon in the CNS and ganglia of the mouse.

Köhler CN
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2011 May;59(5):504-17

---

Mapping the Subcellular Protein Distribution in Three Human Cell Lines

Fagerberg L, Stadler C, Skogs M, Hjelmare M, Jonasson K, Wiking M, Åbergh A, Uhlén M, Lundberg E
Journal of Proteome Research 2011 August;10(8):3766-3777

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-CALD1 antibody. Corresponding CALD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Orthogonal method

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Show more

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Independent antibody validation

Main image

Experimental details

Western blot analysis using Anti-CALD1 antibody HPA008066 (A) shows similar pattern to independent antibody HPA017330 (B).

Antibody #2 product nr

HPA017330

Antibody provider

Atlas Antibodies

Show more

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human smooth muscle and skeletal muscle tissues using Anti-CALD1 antibody. Corresponding CALD1 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Independent antibody validation

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex, placenta, skeletal muscle and smooth muscle using Anti-CALD1 antibody HPA008066 (A) shows similar protein distribution across tissues to independent antibody HPA017330 (B).

Antibody #2 product nr

HPA017330

Antibody provider

Atlas Antibodies

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human smooth muscle shows high expression.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta using Anti-CALD1 antibody HPA008066.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex using Anti-CALD1 antibody HPA008066.

Sample type

HUMAN