Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008019 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008019, RRID:AB_1846946
- Product name
- Anti-CLIC4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKL
SPKHPESNTAGMDIFAKFSAYIKNSRPEANEALER
GLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRK
FLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPK
EMTGI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Histamine H3 receptors aggravate cerebral ischaemic injury by histamine-independent mechanisms.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Impact of genomic stability on protein expression in endometrioid endometrial cancer.
Yan H, Zhang X, Hu W, Ma J, Hou W, Zhang X, Wang X, Gao J, Shen Y, Lv J, Ohtsu H, Han F, Wang G, Chen Z
Nature communications 2014 Feb 25;5:3334
Nature communications 2014 Feb 25;5:3334
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Impact of genomic stability on protein expression in endometrioid endometrial cancer.
Lomnytska MI, Becker S, Gemoll T, Lundgren C, Habermann J, Olsson A, Bodin I, Engström U, Hellman U, Hellman K, Hellström AC, Andersson S, Mints M, Auer G
British journal of cancer 2012 Mar 27;106(7):1297-305
British journal of cancer 2012 Mar 27;106(7):1297-305
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, endometrium, kidney and skeletal muscle using Anti-CLIC4 antibody HPA008019 (A) shows similar protein distribution across tissues to independent antibody HPA060804 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-CLIC4 antibody HPA008019.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium using Anti-CLIC4 antibody HPA008019.
- Sample type
- HUMAN