AMAb91160
antibody from Atlas Antibodies
Targeting: LAMB3
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91160 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91160, RRID:AB_2665825
- Product name
- Anti-LAMB3
- Antibody type
- Monoclonal
- Reactivity
- Human, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQ
QLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS
MLGEQGARIQSVKTEAEELFGETMEMMDRMKDMEL
ELLRGSQAIMLRSADLTGLEKRVEQ- Epitope
- Binds to an epitope located within the peptide sequence ASEQALSAQEGFERI as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3353
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human lung tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A-431 cells using the Anti-LAMB3 monoclonal antibody, showing specific staining in the endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder wall shows positivity in basement membrane of squamous epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat rectum shows immunoreactivity in basement membrane of glandular epithelium and in blood vessels.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat lung shows positivity in basement membrane of respiratory epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat kidney shows immunoreactivity in renal glomerulus.