Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003993-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003993-M06, RRID:AB_565915
- Product name
- LLGL2 monoclonal antibody (M06), clone 4G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LLGL2.
- Antigen sequence
SLKVKGGASELQEDESFTLRGPPGAAPSATQITVV
LPHSSCELLYLGTESGNVFVVQLPAFRALEDRTIS
SDAVLQRLPEEARHRRVFEMVEALQEHPR- Isotype
- IgG
- Antibody clone number
- 4G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A conserved polybasic domain mediates plasma membrane targeting of Lgl and its regulation by hypoxia.
Distinguishing Barrett gastric foveolar dysplasia from reactive cardiac mucosa in gastroesophageal reflux disease.
Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
Loss of Scribble causes cell competition in mammalian cells.
Involvement of Lgl and Mahjong/VprBP in cell competition.
ASPP2 regulates epithelial cell polarity through the PAR complex.
Dong W, Zhang X, Liu W, Chen YJ, Huang J, Austin E, Celotto AM, Jiang WZ, Palladino MJ, Jiang Y, Hammond GR, Hong Y
The Journal of cell biology 2015 Oct 26;211(2):273-86
The Journal of cell biology 2015 Oct 26;211(2):273-86
Distinguishing Barrett gastric foveolar dysplasia from reactive cardiac mucosa in gastroesophageal reflux disease.
Patil DT, Bennett AE, Mahajan D, Bronner MP
Human pathology 2013 Jun;44(6):1146-53
Human pathology 2013 Jun;44(6):1146-53
Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
Russ A, Louderbough JM, Zarnescu D, Schroeder JA
PloS one 2012;7(10):e47734
PloS one 2012;7(10):e47734
Loss of Scribble causes cell competition in mammalian cells.
Norman M, Wisniewska KA, Lawrenson K, Garcia-Miranda P, Tada M, Kajita M, Mano H, Ishikawa S, Ikegawa M, Shimada T, Fujita Y
Journal of cell science 2012 Jan 1;125(Pt 1):59-66
Journal of cell science 2012 Jan 1;125(Pt 1):59-66
Involvement of Lgl and Mahjong/VprBP in cell competition.
Tamori Y, Bialucha CU, Tian AG, Kajita M, Huang YC, Norman M, Harrison N, Poulton J, Ivanovitch K, Disch L, Liu T, Deng WM, Fujita Y
PLoS biology 2010 Jul 13;8(7):e1000422
PLoS biology 2010 Jul 13;8(7):e1000422
ASPP2 regulates epithelial cell polarity through the PAR complex.
Cong W, Hirose T, Harita Y, Yamashita A, Mizuno K, Hirano H, Ohno S
Current biology : CB 2010 Aug 10;20(15):1408-14
Current biology : CB 2010 Aug 10;20(15):1408-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody (M06), clone 4G2.Lane 1: LLGL2 transfected lysate(113 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LLGL2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
