Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405454 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Calcitonin Receptor-Like (CALCRL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLF
YLTII GHGLSIASLL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Unaltered mRNA expression of calcitonin-like receptor and receptor activity modifying proteins in human arteries in stroke and myocardial infarction.
Eskesen K, János T, Tibor H, Délia S, László V, Edvinsson L
Ideggyogyaszati szemle 2007 Nov 30;60(11-12):459-66
Ideggyogyaszati szemle 2007 Nov 30;60(11-12):459-66
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting