H00026135-M01
antibody from Abnova Corporation
Targeting: SERBP1
CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1
Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026135-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026135-M01, RRID:AB_425924
- Product name
- PAI-RBP1 monoclonal antibody (M01), clone 1D2-2E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PAI-RBP1.
- Antigen sequence
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAE
NKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEG
IRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGR
GRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ
SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK
EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKK
GFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE
INFGDLGRPGRGGRGGRGGCGRGGRPNRGSRTDKS
SASAPDVDDPEAFPALA- Isotype
- IgG
- Antibody clone number
- 1D2-2E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Localization of SERBP1 in stress granules and nucleoli.
Protein arginine methylation of SERBP1 by protein arginine methyltransferase 1 affects cytoplasmic/nuclear distribution.
Serologic markers of effective tumor immunity against chronic lymphocytic leukemia include nonmutated B-cell antigens.
An integrated approach of differential mass spectrometry and gene ontology analysis identified novel proteins regulating neuronal differentiation and survival.
Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells.
Lee YJ, Wei HM, Chen LY, Li C
The FEBS journal 2014 Jan;281(1):352-64
The FEBS journal 2014 Jan;281(1):352-64
Protein arginine methylation of SERBP1 by protein arginine methyltransferase 1 affects cytoplasmic/nuclear distribution.
Lee YJ, Hsieh WY, Chen LY, Li C
Journal of cellular biochemistry 2012 Aug;113(8):2721-8
Journal of cellular biochemistry 2012 Aug;113(8):2721-8
Serologic markers of effective tumor immunity against chronic lymphocytic leukemia include nonmutated B-cell antigens.
Marina O, Hainz U, Biernacki MA, Zhang W, Cai A, Duke-Cohan JS, Liu F, Brusic V, Neuberg D, Kutok JL, Alyea EP, Canning CM, Soiffer RJ, Ritz J, Wu CJ
Cancer research 2010 Feb 15;70(4):1344-55
Cancer research 2010 Feb 15;70(4):1344-55
An integrated approach of differential mass spectrometry and gene ontology analysis identified novel proteins regulating neuronal differentiation and survival.
Kobayashi D, Kumagai J, Morikawa T, Wilson-Morifuji M, Wilson A, Irie A, Araki N
Molecular & cellular proteomics : MCP 2009 Oct;8(10):2350-67
Molecular & cellular proteomics : MCP 2009 Oct;8(10):2350-67
Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells.
Süss C, Czupalla C, Winter C, Pursche T, Knoch KP, Schroeder M, Hoflack B, Solimena M
Molecular & cellular proteomics : MCP 2009 Mar;8(3):393-408
Molecular & cellular proteomics : MCP 2009 Mar;8(3):393-408
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PAI-RBP1 monoclonal antibody (M01), clone 1D2-2E9 Western Blot analysis of PAI-RBP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SERBP1 expression in transfected 293T cell line by PAI-RBP1 monoclonal antibody (M01), clone 1D2-2E9.Lane 1: SERBP1 transfected lysate(45 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SERBP1 is 0.3 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PAI-RBP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol