H00026135-M01

SERBP1 antibody from Abnova Corporation
CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1

Antibody data

Product number
H00026135-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026135-M01, RRID:AB_425924
Product name
PAI-RBP1 monoclonal antibody (M01), clone 1D2-2E9
Provider product page
Abnova Corporation - H00026135-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant PAI-RBP1.
Antigen sequence
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAE
NKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEG
IRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGR
GRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ
SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK
EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKK
GFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE
INFGDLGRPGRGGRGGRGGCGRGGRPNRGSRTDKS
SASAPDVDDPEAFPALA
Isotype
IgG
Antibody clone number
1D2-2E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -