H00026135-M02

SERBP1 antibody from Abnova Corporation
CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1

Antibody data

Product number
H00026135-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026135-M02, RRID:AB_1137028
Product name
SERBP1 monoclonal antibody (M02), clone 1G5-2D7
Provider product page
Abnova Corporation - H00026135-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SERBP1.
Antigen sequence
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAE
NKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEG
IRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGR
GRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ
SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK
EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKK
GFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE
INFGDLGRPGRGGRGGRGGCGRGGRPNRGSRTDKS
SASAPDVDDPEAFPALA
Isotype
IgG
Antibody clone number
1G5-2D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -