HPA021878

EIF4A3 antibody from Atlas Antibodies
DDX48, EIF4AIII, Fal1, KIAA0111
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021878
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021878, RRID:AB_1848090
Product name
Anti-EIF4A3
Provider product page
Atlas Antibodies - HPA021878
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVD
VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK
QIIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -