H00009775-A01

EIF4A3 antibody from Abnova Corporation
DDX48, EIF4AIII, Fal1, KIAA0111
No application information provided.

Antibody data

Product number
H00009775-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009775-A01, RRID:AB_529777
Product name
DDX48 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00009775-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant DDX48.
Antigen sequence
PQKERESIMKEFRSGASRVLISTDVWARGLDVPQV
SLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFV
KNDDIRILRDIEQYYSTQIDEMPMNVADLI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -