WH0054331M3

GNG2 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider

Antibody data

Product number
WH0054331M3
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0054331M3, RRID:AB_1841817
Product name
Monoclonal Anti-GNG2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0054331M3
Antibody type
Monoclonal
Antigen
GNG2 (AAH20774, a.a. 1-72) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAA
DLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
L* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -