HPA061626

GTF2B antibody from Atlas Antibodies
TFIIB
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA061626
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061626, RRID:AB_2684570
Product name
Anti-GTF2B
Provider product page
Atlas Antibodies - HPA061626
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDR
VIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGD
LSTMIGKGTGAASFDEFG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -