AV100990

GTF2B antibody from Sigma-Aldrich
TFIIB
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV100990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV100990, RRID:AB_1857940
Product name
Anti-GTF2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV100990
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GTF2B with an internal ID of P02087.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
SSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLF
KQVYEQKSLKGRAND
Storage
-20C
Provider Type Product Number
- No reagents -