HPA008023

antibody from Atlas Antibodies

Targeting: CEL BSSL, MODY8

Antibody data

Submit

Validation data

Product number: HPA008023 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008023, RRID:AB_1846509
Product name: Anti-CEL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRY WTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGD SG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CEL protein structure - HPA008023 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CEL antibody. Corresponding CEL RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human lactating breast, cerebral cortex, liver and pancreas using Anti-CEL antibody HPA008023 (A) shows similar protein distribution across tissues to independent antibody HPA052701 (B).
Antibody #2 product nr: HPA052701
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lactating breast using Anti-CEL antibody HPA008023.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CEL antibody HPA008023.
Sample type: HUMAN