H00008556-M01
antibody from Abnova Corporation
Targeting: CDC14A
cdc14, Cdc14A1, Cdc14A2, DFNB105, DFNB32
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008556-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008556-M01, RRID:AB_437081
- Product name
- CDC14A monoclonal antibody (M01), clone 2C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDC14A.
- Antigen sequence
PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTS
LSSGATVRSFSINSRLASSLGNLNAATDDPENKKT
SSSSKAGFTASPFTNLLNGSSQPTTRNYPE- Isotype
- IgG
- Antibody clone number
- 2C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CDC14A expression in transfected 293T cell line by CDC14A monoclonal antibody (M01), clone 2C12.Lane 1: CDC14A transfected lysate(66.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDC14A is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CDC14A on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol