Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004632-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004632-A01, RRID:AB_463349
- Product name
- MYL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant MYL1.
- Antigen sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVL
RALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL
PMMQAISNNK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Functional analysis of beef tenderness.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B
Journal of proteomics 2011 Dec 21;75(2):352-65
Journal of proteomics 2011 Dec 21;75(2):352-65
No comments: Submit comment
No validations: Submit validation data