HPA055298

antibody from Atlas Antibodies

Targeting: CASQ2 PDIB2

Antibody data

Submit

Validation data

Product number: HPA055298 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA055298, RRID:AB_2682777
Product name: Anti-CASQ2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CASQ2 protein structure - HPA055298 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and skin tissues using Anti-CASQ2 antibody. Corresponding CASQ2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human heart muscle, lymph node, skeletal muscle and skin using Anti-CASQ2 antibody HPA055298 (A) shows similar protein distribution across tissues to independent antibody HPA027285 (B).
Antibody #2 product nr: HPA027285
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle using Anti-CASQ2 antibody HPA055298.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CASQ2 antibody HPA055298.
Sample type: HUMAN