AV32762

PIAS3 antibody from MilliporeSigma / Merck KGaA
FLJ14651, ZMIZ5
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV32762
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV32762, RRID:AB_1855359
Product name
Anti-PIAS3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV32762
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PIAS3 with an internal ID of P03777
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLA
PTLGSSHCSATPAPP
Storage
-20C
Provider Type Product Number
- No reagents -