HPA025820

antibody from Atlas Antibodies

Targeting: ZBTB7B c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B

Antibody data

Submit

Validation data

Product number: HPA025820 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025820, RRID:AB_1859045
Product name: Anti-ZBTB7B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAA CMEILQGSGLEAPSPDEDDCERARQYLEAFATATA SGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRK AFLQTKG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZBTB7B protein structure - HPA025820 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-ZBTB7B antibody HPA025820 (A) shows similar protein distribution across tissues to independent antibody HPA006811 (B).
Antibody #2 product nr: HPA006811
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ZBTB7B antibody HPA025820.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ZBTB7B antibody HPA025820.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ZBTB7B antibody HPA025820.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ZBTB7B antibody HPA025820.
Sample type: HUMAN