HPA017046
antibody from Atlas Antibodies
Targeting: ARHGEF2
GEF-H1, GEFH1, KIAA0651, Lfc, LFP40, P40
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017046 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ARHGEF2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRG
RSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQST
DSLNMRNRTLSVESLIDEEVIYSELMSDFEMDEKD
FAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQ- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway
GEF‐H1 over‐expression in hepatocellular carcinoma promotes cell motility via activation of RhoA signalling
Overexpressed hPTTG1 promotes breast cancer cell invasion and metastasis by regulating GEF-H1/RhoA signalling
Arabi A, Ullah K, Branca R, Johansson J, Bandarra D, Haneklaus M, Fu J, Ariës I, Nilsson P, Den Boer M, Pokrovskaja K, Grandér D, Xiao G, Rocha S, Lehtiö J, Sangfelt O
Nature Communications 2012;3(1)
Nature Communications 2012;3(1)
GEF‐H1 over‐expression in hepatocellular carcinoma promotes cell motility via activation of RhoA signalling
Cheng I, Tsang B, Lai K, Ching A, Chan A, To K, Lai P, Wong N
The Journal of Pathology 2012;228(4):575-585
The Journal of Pathology 2012;228(4):575-585
Overexpressed hPTTG1 promotes breast cancer cell invasion and metastasis by regulating GEF-H1/RhoA signalling
Liao Y, Ruan J, Lua I, Li M, Chen W, Wang J, Kao R, Chen J
Oncogene 2011;31(25):3086-3097
Oncogene 2011;31(25):3086-3097
No comments: Submit comment
No validations: Submit validation data