Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004135 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004135, RRID:AB_1846516
- Product name
- Anti-CRABP2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVD
GRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRE
LTNDGELILTMTADDVVCTRVYVRE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma.
Seidensaal K, Nollert A, Feige AH, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber KJ, Plinkert P, Simon C, Hess J
Molecular cancer 2015 Dec 3;14:204
Molecular cancer 2015 Dec 3;14:204
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines MCF-7 and A-549 using Anti-CRABP2 antibody. Corresponding CRABP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and CRABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419677).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human vulva/anal skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.
- Sample type
- HUMAN